PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn185121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 390aa    MW: 43198.4 Da    PI: 8.1736
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn185121genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.41.4e-3247101155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kprl+Wt++LHerF+ av+qLGG++kAtPkt+l++m+++gLtl+h+kSHLQkYRl
  Achn185121  47 KPRLKWTQDLHERFIAAVNQLGGADKATPKTVLKHMGIPGLTLYHLKSHLQKYRL 101
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.87544104IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-3045102IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1646102IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-2347102IPR006447Myb domain, plants
PfamPF002497.9E-1049100IPR001005SANT/Myb domain
PfamPF143793.0E-23144190IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MYHHHHHQGK NIHPSSSRAS IPPERHLFLQ GGNGAGDSGL VLSTDAKPRL KWTQDLHERF  60
IAAVNQLGGA DKATPKTVLK HMGIPGLTLY HLKSHLQKYR LSKNLHGQAN SGGNKTVAGE  120
RMSETNGSHT SNPTIGPQTN ENLQIGEAIQ MQIKVQRRLH EQLEVQRHLQ LRIEAQGKYL  180
QSVLEKAQET LGRQNLGTVG LEAAKVQLSE LVSKVSTQCL NSTFSGVKEL PGGLCPQQRQ  240
TFQPTDCSMD SCLTSCEGSQ RDQDMHKNGM GLIAFNSNAP FWPKEMGKNT ERALPIEVNS  300
DDLSMGVGLQ GGNGTSSSYL ERRFRGMDED LNFREQTTSR ADSIQQEDEK MSQKYKLLYF  360
APKLDLNTRD ENDAASNCKQ IDLNGFSWN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319702.20.0myb family transcription factor family protein
TrEMBLB9I5Z80.0B9I5Z8_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0013s05670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-134G2-like family protein